DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and CG33557

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:115 Identity:36/115 - (31%)
Similarity:59/115 - (51%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QRPSTNGRANGSSSSSKKTRRRVASMAQ---------------RRAANIRERRRMFNLNEAFDKL 109
            |..:::|.|:||.:::.....::...|.               |:..|.|||.|.||:|.|::.|
  Fly    20 QDSNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINARERYRTFNVNSAYEAL 84

  Fly   110 RRKVPTFAYEKRLSRIETLRLAITYIGFMAELL-SGT---PSNSHKSRSD 155
            |..:||....::||:||.:|||.:||..::..| :||   |...||..|:
  Fly    85 RNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQPCLLHKYESE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/62 (34%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.