DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and bhlha9

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001189344.1 Gene:bhlha9 / 323481 ZFINID:ZDB-GENE-030131-2201 Length:260 Species:Danio rerio


Alignment Length:186 Identity:51/186 - (27%)
Similarity:72/186 - (38%) Gaps:70/186 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAE 140
            ||..|.|.|.|:|.|||:|||:|:.:.|:||:.||..:......||||:|.||:.||..|..::.
Zfish    54 KKRSRPVRSKARRVAANVRERKRILDYNQAFNALRVALHHDLSGKRLSKIATLQRAINRISALSV 118

  Fly   141 LLSGTPS-----------------------------------NSHKSRSDVYGSMNGHH----QA 166
            .|:..|.                                   |.|...| ::...:..|    .|
Zfish   119 FLTNNPPVGVAKPCGHLECQPGGLWAEAEPSMQNFLTWHQPLNQHLQTS-IHRLSSEQHVFTGPA 182

  Fly   167 PPPAIHPHH--------LHPAA---------------AYQR-----DFASPYNHSL 194
            .||:  ||:        |:|||               |||:     :.|..|..||
Zfish   183 CPPS--PHYPCFSPDNQLYPAASVPSPPRYGRIGDVGAYQQGVWGGNHADGYGESL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 22/47 (47%)
bhlha9NP_001189344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..49
HLH 65..116 CDD:278439 23/50 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.