DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Tal1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001101428.2 Gene:Tal1 / 313507 RGDID:1306748 Length:329 Species:Rattus norvegicus


Alignment Length:244 Identity:67/244 - (27%)
Similarity:94/244 - (38%) Gaps:72/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PHPIDQPTYMP-DVPFQPLWGQEAPP---PPIVPYQELIAGF--PCTDL--SLWQRSQVTPL--- 57
            |.|...|...| ::|......|.:||   .|..|.:.|:...  |...|  ..:......|:   
  Rat    99 PAPAPAPASAPAELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTN 163

  Fly    58 ---VPQRPS------TNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKV 113
               |.:|||      |:|       ...|..||:.:       |.|||.|..|:|.||.:||:.:
  Rat   164 NNRVKRRPSPYEMEITDG-------PHTKVVRRIFT-------NSRERWRQQNVNGAFAELRKLI 214

  Fly   114 PTFAYEKRLSRIETLRLAITYIGFMAELLS-----GT---------------------------- 145
            ||...:|:||:.|.||||:.||.|:|:||:     ||                            
  Rat   215 PTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKPGKDPMVGAGGGGAGGGIPPEDLL 279

  Fly   146 -----PSNSHKSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASP 189
                 |::|..|..|...|.:.:.:.|.|...|..||||.....|.|.|
  Rat   280 QDVLSPNSSCGSSLDGAASPDSYTEEPTPKHTPRSLHPALLPAADGAGP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/47 (45%)
Tal1NP_001101428.2 bHLH_TS_TAL1 185..249 CDD:381549 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.