DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and HLH3B

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:133 Identity:41/133 - (30%)
Similarity:59/133 - (44%) Gaps:27/133 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 STNGRANGS---SSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSR 124
            |..|..|||   :||...:........::...|.|||.|..|::.||.:||:.|||...:|:||:
  Fly   139 SGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSK 203

  Fly   125 IETLRLAITYIGFMAELLSG------TPSNSHKSRSDVYGSMNGHHQA--------------PPP 169
            .|.||.||.||    :||:|      ..:.||..|:.:..:.|.:..|              .||
  Fly   204 NEILRSAIKYI----KLLTGILEWQQRQAPSHPIRAQMEPNNNDNRMANGHAADGENLENPDVPP 264

  Fly   170 AIH 172
            ..|
  Fly   265 VRH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/47 (45%)
HLH3BNP_525055.1 HLH 171..222 CDD:197674 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.