DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and l(1)sc

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster


Alignment Length:213 Identity:50/213 - (23%)
Similarity:79/213 - (37%) Gaps:69/213 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QHPHPIDQPTYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNG 66
            ||.|...|...:            ||..|:...|       ..::...|:|.|.|::        
  Fly    27 QHHHQTQQHQLI------------APKIPLGTSQ-------LQNMQQSQQSNVGPML-------- 64

  Fly    67 RANGSSSSSKKTR-------RRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAY------ 118
                 ||..||..       .::.|:|:|   |.|||.|:..:|..|..||:.:|....      
  Fly    65 -----SSQKKKFNYNNMPYGEQLPSVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNG 121

  Fly   119 ----EKRLSRIETLRLAITYIGFMAELL-SGT-------------PSNSHKSRSDVYGSMNGHHQ 165
                .|:||:::|||:|:.||..:.::| .||             .||...|.:|...|::...|
  Fly   122 GRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQ 186

  Fly   166 ---APPPAIHPHHLHPAA 180
               ....:...|..|.|:
  Fly   187 FLTGATQSAQSHSYHSAS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 18/57 (32%)
l(1)scNP_476623.1 HLH <96..146 CDD:278439 14/49 (29%)
Peptidase_C11 <128..218 CDD:304483 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.