DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and neurog1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_571116.1 Gene:neurog1 / 30239 ZFINID:ZDB-GENE-990415-174 Length:208 Species:Danio rerio


Alignment Length:154 Identity:48/154 - (31%)
Similarity:64/154 - (41%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RSQVTPLVPQRPSTNGRANGSSSSSKKTRR---------RVASMAQRRAANIRERRRMFNLNEAF 106
            ||.:.|..|........|:.:....||.||         .|....:|..||.|||.||.|||:|.
Zfish    26 RSSLHPASPASSCGKPPASPAGLQQKKRRRGRARNETTVHVVKKNRRLKANDRERNRMHNLNDAL 90

  Fly   107 DKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSHKSRSDVYGSMNGHHQAPPPAI 171
            |.||..:|.|..:.:|::|||||.|..||..::|.:........|||.   |.:           
Zfish    91 DALRSVLPAFPDDTKLTKIETLRFAHNYIWALSETIRIADQKQGKSRD---GPL----------- 141

  Fly   172 HPHHLHPAAAYQRDFASPYNHSLS 195
                |.|..:...|..||.:.|.|
Zfish   142 ----LLPGLSCMADAPSPGSDSCS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/47 (51%)
neurog1NP_571116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 9/35 (26%)
CCDC106 <20..>102 CDD:292422 27/75 (36%)
HLH 68..127 CDD:238036 27/58 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..180 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.