DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and neurod1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_571053.1 Gene:neurod1 / 30169 ZFINID:ZDB-GENE-990415-172 Length:350 Species:Danio rerio


Alignment Length:155 Identity:49/155 - (31%)
Similarity:71/155 - (45%) Gaps:36/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RPSTNGRANGSSSSSKKTRRRVASMAQRR-AANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSR 124
            :|...|     ....|.|:.|:.....|| .||.|||.||..||:|.:.||:.||.::..::||:
Zfish    75 KPKRRG-----PKKKKMTKARMQRFKMRRMKANARERNRMHGLNDALESLRKVVPCYSKTQKLSK 134

  Fly   125 IETLRLAITYIGFMAELL-SGTPSN------------SHKSRSDVYGSMN--------GHHQAPP 168
            |||||||..||..::|:| ||...:            |..:.:.|.|.:.        ...|..|
Zfish   135 IETLRLAKNYIWALSEILRSGKSPDLMSFVQALCKGLSQPTTNLVAGCLQLNPRTFLPEQSQEMP 199

  Fly   169 PAIHPHHLHPAAAYQRDF-ASPYNH 192
            |     |:..|:|   .| |.||::
Zfish   200 P-----HMQTASA---SFSALPYSY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/48 (52%)
neurod1NP_571053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 4/20 (20%)
Nuclear localization signal. /evidence=ECO:0000255 82..88 1/5 (20%)
HLH 95..153 CDD:238036 28/57 (49%)
Neuro_bHLH 155..277 CDD:289310 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.