Sequence 1: | NP_524322.1 | Gene: | Fer3 / 41411 | FlyBaseID: | FBgn0037937 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_835455.1 | Gene: | PTF1A / 256297 | HGNCID: | 23734 | Length: | 328 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 64/204 - (31%) |
---|---|---|---|
Similarity: | 95/204 - (46%) | Gaps: | 58/204 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 PFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNGRA-NGSSSSSKKTRR 80
Fly 81 RVASMAQ----RRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAEL 141
Fly 142 LS-------------GTPSNSHKSRSDVYGSM-------NGHHQAPPPAIHPHHLHPAAAYQRDF 186
Fly 187 ASPYNHSLS 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fer3 | NP_524322.1 | HLH | 87..135 | CDD:278439 | 29/51 (57%) |
PTF1A | NP_835455.1 | HLH | 165..220 | CDD:238036 | 34/54 (63%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 259..278 | 5/28 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..328 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2562 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |