DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Bhlha15

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_036995.1 Gene:Bhlha15 / 25334 RGDID:3091 Length:197 Species:Rattus norvegicus


Alignment Length:166 Identity:54/166 - (32%)
Similarity:78/166 - (46%) Gaps:16/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVAS 84
            |:...||.|....|.:.. :|...::::...||:.......|...:.|..||||      ||..|
  Rat    13 PMQDAEATPGEQTPDRSQ-SGSGASEVTKGLRSRTARASGTRAEVSRRRQGSSS------RRENS 70

  Fly    85 MAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYI-GFMAELLSGTPSN 148
            :.:|..:|.|||:||..||.||..||..:|....:|:||:||||.||..|| ...|.:|  |.|:
  Rat    71 VQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATIL--TMSS 133

  Fly   149 SHKSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQR 184
            |.....:..|      .||.|.::.|:.|.....|:
  Rat   134 SRLPGLEAPG------PAPGPKLYQHYHHQQQQQQQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 23/47 (49%)
Bhlha15NP_036995.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 20/75 (27%)
HLH 70..124 CDD:238036 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5279
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.