DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Ascl5

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001257538.1 Gene:Ascl5 / 226439 MGIID:2685043 Length:188 Species:Mus musculus


Alignment Length:205 Identity:57/205 - (27%)
Similarity:77/205 - (37%) Gaps:67/205 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QHPHPIDQPTYMPDVPFQPLWGQEAPP-----PPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQR 61
            |.|....:|  :.:|||....|...||     ..:.||......|...|.         |..|  
Mouse    28 QTPLAATEP--LSNVPFLLYPGHSEPPYYDAYTGVFPYVPFPGAFGVYDY---------PFEP-- 79

  Fly    62 PSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIE 126
                                  :..|:|  |.|||:|:..:||.:.:||..:|....|||||::|
Mouse    80 ----------------------AFIQKR--NERERQRVKCVNEGYARLRGHLPGALTEKRLSKVE 120

  Fly   127 TLRLAITYIGFMAELLSGTPSNSHKSRSDVYGSMNGHHQAPPPAIHPHHLH--------PAAAYQ 183
            |||.||.||.::.||||.||..                 |||||..|...|        |::...
Mouse   121 TLRAAIRYIKYLQELLSATPDG-----------------APPPATSPPPAHTGHSNVPQPSSLVA 168

  Fly   184 RDFASPYNHS 193
            ....||::.|
Mouse   169 ESSGSPFSSS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 23/47 (49%)
Ascl5NP_001257538.1 HLH 86..136 CDD:197674 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.