DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and ATOH7

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_660161.1 Gene:ATOH7 / 220202 HGNCID:13907 Length:152 Species:Homo sapiens


Alignment Length:111 Identity:41/111 - (36%)
Similarity:62/111 - (55%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RVASMAQRR-AANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSG 144
            |:.|.|:|| |||.||||||..||.|||:|||.||.:..:|:||:.|||::|::||..:..:|  
Human    34 RLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRIL-- 96

  Fly   145 TPSNSHKSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASPY 190
                   :.::.:||     :.....:|..|      :.||...|:
Human    97 -------AEAERFGS-----ERDWVGLHCEH------FGRDHYLPF 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 28/48 (58%)
ATOH7NP_660161.1 bHLH_TS_ATOH7 34..102 CDD:381557 34/76 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.