Sequence 1: | NP_524322.1 | Gene: | Fer3 / 41411 | FlyBaseID: | FBgn0037937 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006502972.1 | Gene: | Tal1 / 21349 | MGIID: | 98480 | Length: | 335 | Species: | Mus musculus |
Alignment Length: | 238 | Identity: | 64/238 - (26%) |
---|---|---|---|
Similarity: | 89/238 - (37%) | Gaps: | 60/238 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 PHPIDQPTYMP-DVPFQPLWGQEAPP---PPIVPYQELIAGF--PCTDL--SLWQRSQVTPL--- 57
Fly 58 ---VPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYE 119
Fly 120 KRLSRIETLRLAITYIGFMAELLS-----GT---------------------------------P 146
Fly 147 SNSHKSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASP 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fer3 | NP_524322.1 | HLH | 87..135 | CDD:278439 | 21/47 (45%) |
Tal1 | XP_006502972.1 | bHLH_TS_TAL1 | 191..255 | CDD:381549 | 30/71 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |