DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Tal1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_006502972.1 Gene:Tal1 / 21349 MGIID:98480 Length:335 Species:Mus musculus


Alignment Length:238 Identity:64/238 - (26%)
Similarity:89/238 - (37%) Gaps:60/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PHPIDQPTYMP-DVPFQPLWGQEAPP---PPIVPYQELIAGF--PCTDL--SLWQRSQVTPL--- 57
            |.|...|...| ::|......|.:||   .|..|.:.|:...  |...|  ..:......|:   
Mouse   105 PAPAPAPASAPAELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTN 169

  Fly    58 ---VPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYE 119
               |.:|||...........:|..||..        .|.|||.|..|:|.||.:||:.:||...:
Mouse   170 NNRVKRRPSPYEMEISDGPHTKVVRRIF--------TNSRERWRQQNVNGAFAELRKLIPTHPPD 226

  Fly   120 KRLSRIETLRLAITYIGFMAELLS-----GT---------------------------------P 146
            |:||:.|.||||:.||.|:|:||:     ||                                 |
Mouse   227 KKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKPGKDPVVGAGGGGAGGGIPPEDLLQDVLSP 291

  Fly   147 SNSHKSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASP 189
            ::|..|..|...|.:.:.:.|.|......||||.....|.|.|
Mouse   292 NSSCGSSLDGAASPDSYTEEPTPKHTSRSLHPALLPAADGAGP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/47 (45%)
Tal1XP_006502972.1 bHLH_TS_TAL1 191..255 CDD:381549 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.