DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Ptf1a

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus


Alignment Length:222 Identity:70/222 - (31%)
Similarity:101/222 - (45%) Gaps:66/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PIDQPTYMPDV-------PFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPS 63
            |.|..:|..|.       |:.|     ..||..:.|       ||..:          |.|  .:
Mouse    92 PEDNVSYCCDAGAPLAAFPYSP-----GSPPSCLAY-------PCAAV----------LSP--GA 132

  Fly    64 TNGRANG-SSSSSKKTRRRVASMAQ----RRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLS 123
            ..|..|| :::::.:.||||.|.|:    |:|||:||||||.::|:||:.||..:||..||||||
Mouse   133 RLGGLNGAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLS 197

  Fly   124 RIETLRLAITYIGFMAELLS-------------GTPSNSHKSRSDVYGSM-------NGHHQAPP 168
            :::||||||.||.|::||:.             |.|..|.....|..|:.       :...::|.
Mouse   198 KVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPS 262

  Fly   169 PAIHPHHLHPAAAYQRDFASPYNHSLS 195
            |:...:.|.|.|          .||||
Mouse   263 PSDPDYGLPPLA----------GHSLS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 29/51 (57%)
Ptf1aNP_061279.2 HLH 162..217 CDD:238036 34/54 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.