DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and hlh-13

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_508725.1 Gene:hlh-13 / 185980 WormBaseID:WBGene00001957 Length:147 Species:Caenorhabditis elegans


Alignment Length:81 Identity:37/81 - (45%)
Similarity:54/81 - (66%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNS-- 149
            :|:.|:||||:||.::|.||.:||..:|||.||||||:|:||.|||.||..:.::|. ||.:|  
 Worm    42 ERQTASIRERKRMCSINVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVLR-TPEDSGQ 105

  Fly   150 ------HKSRSDVYGS 159
                  |.:|:...|:
 Worm   106 YIQKCVHMARTGQIGA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 28/47 (60%)
hlh-13NP_508725.1 HLH 43..93 CDD:278439 30/49 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.