DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and cnd-1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001379767.1 Gene:cnd-1 / 183212 WormBaseID:WBGene00000561 Length:192 Species:Caenorhabditis elegans


Alignment Length:161 Identity:47/161 - (29%)
Similarity:65/161 - (40%) Gaps:48/161 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRI 125
            ||:.......:..|.:|.|        |..||.|||.||..||.|.|.||..:|.....::||:|
 Worm     2 RPTDTSNFAPAEISKRKVR--------RVKANGRERARMHGLNNALDMLREYIPITTQHQKLSKI 58

  Fly   126 ETLRLAITYIGFMAEL-------------------LSGTPSNS-------------HKSRSDVYG 158
            ||||||..||..:..:                   ||.|.:|.             ..|:.|:: 
 Worm    59 ETLRLARNYIDALQRMLQTNEQPTPLEYAHTLANGLSQTTTNMLANLLQVQPRQLLPPSQFDIF- 122

  Fly   159 SMNGHHQAPPPAIHPHHLHPAAAYQRDFASP 189
            |...|||     :||.|..|.:::..  :||
 Worm   123 SDPSHHQ-----LHPSHPPPHSSFSS--SSP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/47 (51%)
cnd-1NP_001379767.1 bHLH_TS_NeuroD 21..75 CDD:381433 26/53 (49%)
Neuro_bHLH 78..>129 CDD:403655 8/51 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.