powered by:
Protein Alignment Fer3 and Nhlh1
DIOPT Version :9
Sequence 1: | NP_524322.1 |
Gene: | Fer3 / 41411 |
FlyBaseID: | FBgn0037937 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_035046.1 |
Gene: | Nhlh1 / 18071 |
MGIID: | 98481 |
Length: | 133 |
Species: | Mus musculus |
Alignment Length: | 70 |
Identity: | 31/70 - (44%) |
Similarity: | 44/70 - (62%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 SSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGF 137
|..::.|||.|:...|.|...|||.|:...|.||.:||:.:||...:|:||:||.|||||.||.:
Mouse 62 SREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISY 126
Fly 138 MAELL 142
:..:|
Mouse 127 LNHVL 131
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.