DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Bhlha15

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_034930.1 Gene:Bhlha15 / 17341 MGIID:891976 Length:197 Species:Mus musculus


Alignment Length:157 Identity:51/157 - (32%)
Similarity:70/157 - (44%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QRSQVTP--LVPQRP--------------STNGRANGSSSSSKKTR-----RRVASMAQRRAANI 93
            |.::.||  ..|.||              |...||:|......:.|     ||..|:.:|..:|.
Mouse    15 QDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASGGRGEVSRRRQGSGGRRENSVQRRLESNE 79

  Fly    94 RERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYI-GFMAELLSGTPSNSHKSRSDVY 157
            |||:||..||.||..||..:|....:|:||:||||.||..|| ...|.:|  |.|:|.....:..
Mouse    80 RERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATIL--TMSSSRLPGLEAP 142

  Fly   158 GSMNGHHQAPPPAIHPHHLHPAAAYQR 184
            |      .||.|.::.|:.|.....|:
Mouse   143 G------PAPGPKLYQHYHHQQQQQQQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 23/47 (49%)
Bhlha15NP_034930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 17/66 (26%)
HLH 70..124 CDD:238036 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.