DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and BHLHA15

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_803238.1 Gene:BHLHA15 / 168620 HGNCID:22265 Length:189 Species:Homo sapiens


Alignment Length:116 Identity:39/116 - (33%)
Similarity:57/116 - (49%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSR 124
            :||..:|...          ||.:|:.:|..:|.|||:||..||.||..||..:|....:|:||:
Human    59 RRPGPSGPGG----------RRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSK 113

  Fly   125 IETLRLAITYIGFMAELLSGTPSNSHKSRSDVYGSMNGHHQAPPPAIHPHH 175
            ||||.||..||    :.|:.|......||      :.| .:.|.|.::.|:
Human   114 IETLTLAKNYI----KSLTATILTMSSSR------LPG-LEGPGPKLYQHY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 23/47 (49%)
BHLHA15NP_803238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 9/35 (26%)
HLH 81..127 CDD:197674 24/49 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..189
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.