DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Twist2

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_031881.1 Gene:Twist2 / 13345 MGIID:104685 Length:160 Species:Mus musculus


Alignment Length:90 Identity:35/90 - (38%)
Similarity:54/90 - (60%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QRPSTNGRANGSSSSSKKTRRRVAS-------MAQRRAANIRERRRMFNLNEAFDKLRRKVPTFA 117
            :|.|.....:||.:..|:.::...|       .:||..||:|||:|..:|||||..||:.:||..
Mouse    33 RRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLP 97

  Fly   118 YEKRLSRIETLRLAITYIGFMAELL 142
            .:| ||:|:||:||..||.|:.::|
Mouse    98 SDK-LSKIQTLKLAARYIDFLYQVL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/47 (53%)
Twist2NP_031881.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 6/29 (21%)
bHLH_TS_TWIST2 51..132 CDD:381543 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.