DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and ASCL4

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens


Alignment Length:96 Identity:33/96 - (34%)
Similarity:46/96 - (47%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELL----------- 142
            |..|.|||:|:..:||.:.:||..:|....:||||::||||.||.||..:.|||           
Human    75 RKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAA 139

  Fly   143 SGTPSNSHKSRSDVYGSMNGHHQAPPPAIHP 173
            ...|....:..||.....:   .||.|:..|
Human   140 GAVPQRRAECNSDGESKAS---SAPSPSSEP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/45 (47%)
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:412148 25/53 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.