DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Neurod4

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus


Alignment Length:193 Identity:56/193 - (29%)
Similarity:73/193 - (37%) Gaps:63/193 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RPSTNGRANGSSSSSKKTRRRVASMAQRRA-ANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSR 124
            :|...|     ....|.|:.|:.....||. ||.|||.||..||:|.|.|||.:|.::..::||:
Mouse    66 KPKRRG-----PKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSK 125

  Fly   125 IETLRLAITYI----------------GFMAELLSG-------------------TPSNSHKSRS 154
            |||||||..||                ||:..|..|                   |....|:.:|
Mouse   126 IETLRLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSTLLEKHEEKS 190

  Fly   155 DVYGSMNGHH----QAP----PPAIH--PHHLH----PAAAYQRDFAS--------PYNHSLS 195
            .:..|....|    |:|    ||..|  .|.||    |..:....|.|        ||...|:
Mouse   191 SICDSTISVHSFNYQSPGLPSPPYGHMETHSLHLKPQPFKSLGDSFGSHPPDCSTPPYEGPLT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 26/48 (54%)
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 4/18 (22%)
HLH 88..144 CDD:238036 28/55 (51%)
Neuro_bHLH 146..263 CDD:289310 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.