DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Ferd3l

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus


Alignment Length:161 Identity:75/161 - (46%)
Similarity:91/161 - (56%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QHPHPIDQPTYMPDVPF--QPLWGQEAPPPPIVP----YQELIAGFPCTDLSLWQRSQVTPLVPQ 60
            :||...:.|   |.|||  :.|..:|..|..:..    |||:            :..:|....|:
Mouse    26 RHPLLCEFP---PGVPFGDRTLGYREGRPGRLSQFDERYQEV------------EGDEVEYEDPE 75

  Fly    61 RPSTNGRANGSSSS--SKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLS 123
            .....|...|..:|  .:..|:||.:.|||:|||||||:||||||||||:|||||||||||||||
Mouse    76 EEEEEGEGRGRVASLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLS 140

  Fly   124 RIETLRLAITYIGFMAELLSGTPSNSHKSRS 154
            |||||||||.||.||.|||.   |...|..|
Mouse   141 RIETLRLAIVYISFMTELLQ---SKEEKEAS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 43/47 (91%)
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88 4/22 (18%)
bHLH domain 104..159 48/54 (89%)
HLH 104..156 CDD:278439 46/51 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839667
Domainoid 1 1.000 94 1.000 Domainoid score I7497
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009159
OrthoInspector 1 1.000 - - oto93174
orthoMCL 1 0.900 - - OOG6_109661
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.