powered by:
Protein Alignment Fer3 and neurod6a
DIOPT Version :9
Sequence 1: | NP_524322.1 |
Gene: | Fer3 / 41411 |
FlyBaseID: | FBgn0037937 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017209288.1 |
Gene: | neurod6a / 114414 |
ZFINID: | ZDB-GENE-010608-1 |
Length: | 391 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 35/69 - (50%) |
Similarity: | 46/69 - (66%) |
Gaps: | 1/69 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 KKTRRRVASMAQRR-AANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMA 139
|.|:.||..:..|| .||.|||.||..||.|.|.||:.||.::..::||:|||||||..||..::
Zfish 141 KMTKARVDRVKVRRMEANARERNRMHGLNNALDSLRKVVPCYSKTQKLSKIETLRLAKNYIWALS 205
Fly 140 ELLS 143
|:||
Zfish 206 EILS 209
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Fer3 | NP_524322.1 |
HLH |
87..135 |
CDD:278439 |
26/48 (54%) |
neurod6a | XP_017209288.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.