DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and neurog3

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_571890.1 Gene:neurog3 / 114411 ZFINID:ZDB-GENE-010608-4 Length:208 Species:Danio rerio


Alignment Length:141 Identity:43/141 - (30%)
Similarity:62/141 - (43%) Gaps:38/141 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQR----------------PSTNG 66
            |:..|...:.|.           |..||::   :||  |:...|                .::||
Zfish    16 FKSNWSSASEPK-----------FGSTDMT---KSQ--PIKYNREAELASKEWSFTFREDKTSNG 64

  Fly    67 RANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLA 131
            :.....|:|::...|      |..||.|.|.||.|||.|.|.||..:|||..:.:|::|||||.|
Zfish    65 KLKKLMSTSRQRGNR------RVKANDRGRHRMHNLNSALDNLRSVLPTFPDDAKLTKIETLRFA 123

  Fly   132 ITYIGFMAELL 142
            ..||..::|.|
Zfish   124 RNYIWALSETL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/47 (51%)
neurog3NP_571890.1 HLH 84..135 CDD:197674 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.