DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and LOC110440056

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_021334761.1 Gene:LOC110440056 / 110440056 -ID:- Length:207 Species:Danio rerio


Alignment Length:156 Identity:62/156 - (39%)
Similarity:80/156 - (51%) Gaps:27/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WGQEAPPPPIVPYQELIAGFPC----TDLSLWQ---------RSQV--TPLVPQRPSTNGRANGS 71
            |||..|..|.:..|.....|.|    ..||.|.         .:|:  |.|..|.|.....|...
Zfish    20 WGQMDPSFPQIHSQLDTLLFDCGAMAGQLSPWSSYGCQSVFPEAQLTFTDLDSQSPQLEVGAEVD 84

  Fly    72 SS-------SSKKTRRRVAS----MAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRI 125
            ||       .:::.:|.:|:    ..||.|||||||:||.::|.||::||..||||.||||||:|
Zfish    85 SSLLDEPHEMTQQQQRCLATHHPYKVQRHAANIRERKRMLSINSAFEELRCHVPTFPYEKRLSKI 149

  Fly   126 ETLRLAITYIGFMAE-LLSGTPSNSH 150
            :||||||.||..:.| ||||....|:
Zfish   150 DTLRLAIAYIALLREILLSGCDPKSY 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 33/47 (70%)
LOC110440056XP_021334761.1 HLH 111..163 CDD:306515 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.