DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and ferd3l

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_021323873.1 Gene:ferd3l / 110438133 -ID:- Length:145 Species:Danio rerio


Alignment Length:112 Identity:60/112 - (53%)
Similarity:71/112 - (63%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRR 98
            ||:|      |.:|.........|.|...|.....|     .|..|:||.|..||:|||||||:|
Zfish    45 YQDL------TSISTAPTDYFYALSPSTGSPEIAVN-----MKPKRKRVISTVQRQAANIRERKR 98

  Fly    99 MFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGT 145
            ||:||||||:|||:||||||||||||||||||||.||.||.::|..:
Zfish    99 MFSLNEAFDRLRRRVPTFAYEKRLSRIETLRLAIVYIAFMTDILENS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 41/47 (87%)
ferd3lXP_021323873.1 HLH 87..139 CDD:306515 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7710
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513995at2759
OrthoFinder 1 1.000 - - FOG0009159
OrthoInspector 1 1.000 - - oto40177
orthoMCL 1 0.900 - - OOG6_109661
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.