DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and ascl2

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_002940290.3 Gene:ascl2 / 100494131 XenbaseID:XB-GENE-6458615 Length:236 Species:Xenopus tropicalis


Alignment Length:143 Identity:42/143 - (29%)
Similarity:67/143 - (46%) Gaps:39/143 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 WQRSQV----------TPLVP--------------QRPSTNGR--ANGSSSSSK-KTRRR----- 81
            :||.||          ||:||              :||:...|  ||.|.|..: :.:||     
 Frog    40 FQREQVPSGPTLERKATPVVPVAPPSSAMEEQPGSERPAKAPRKVANQSGSPQRLRCQRRSGSLP 104

  Fly    82 ----VASMAQRRAANIRERRRMFNLNEAFDKLRRKVP-TFAYEKRLSRIETLRLAITYIGFMAEL 141
                :::.::||  |.|||.|:..:|..|.|||:.|| .....|::|::||||.|:.||..:..:
 Frog   105 NAIGISATSERR--NERERNRVKLVNLGFAKLRQHVPQAQGPNKKMSKVETLRSAVEYIRALQSI 167

  Fly   142 LSGTPSNSHKSRS 154
            |....:...:.|:
 Frog   168 LMERTAGEGQGRA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/48 (44%)
ascl2XP_002940290.3 bHLH_TS_ASCL2_Mash2 110..174 CDD:381586 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.