DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and LOC100489188

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_017953149.1 Gene:LOC100489188 / 100489188 -ID:- Length:170 Species:Xenopus tropicalis


Alignment Length:175 Identity:60/175 - (34%)
Similarity:88/175 - (50%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MPDVPFQPLWGQEAPPPPIVPYQELIAGF-------PCT---------DLSLWQR-SQVTPLVPQ 60
            |.|:    ||.   |.|....:.:|.:.|       .||         .:..|.. |||...||.
 Frog     1 MEDI----LWD---PEPDYQLWDQLESTFQLHSEPESCTMDFFPAVTEHVPAWPALSQVVSEVPL 58

  Fly    61 RPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRI 125
            :.:..| |..:||..:::.........|:||||||||||.::|.||::||.:||||.||||||:|
 Frog    59 QLAGLG-AEMNSSFQEESLMEGPCKVHRQAANIRERRRMLSINSAFEELRGRVPTFPYEKRLSKI 122

  Fly   126 ETLRLAITYIGFMAELLSG-----------TPSNSHKSRSDVYGS 159
            :||||||.||..::::||.           ..:.|...:||::.:
 Frog   123 DTLRLAIAYIALLSDILSSGMDPKTYVEEFVRTGSRGPQSDIWNT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 33/47 (70%)
LOC100489188XP_017953149.1 bHLH_TS_ceHLH13_like 80..142 CDD:381422 37/61 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.