DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and tal1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001135468.1 Gene:tal1 / 100196924 XenbaseID:XB-GENE-479827 Length:388 Species:Xenopus tropicalis


Alignment Length:287 Identity:65/287 - (22%)
Similarity:92/287 - (32%) Gaps:135/287 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PIDQPTYMPDVPFQPLWGQEAPPPPIVPYQEL-----------------IAGFPCTDLSLWQRSQ 53
            |:...|.:...|..|.  .|...||:.|..||                 :.|.|.|         
 Frog   107 PLTPTTELCRAPLTPT--TELCRPPLTPAAELCRASLTPAAELCRAPSSVTGPPLT--------- 160

  Fly    54 VT-----PLVPQRPSTN-------------------------GR----------ANGSS------ 72
            ||     |.:| .|||.                         ||          |:|:|      
 Frog   161 VTTELCRPPIP-LPSTGPPAEQAVEARMVQLSPTASLPLQAAGRTMLYGLNQTLASGNSGYFDDP 224

  Fly    73 ------SSSKKTRRR------------VASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYE 119
                  :::.:.:||            ...:.:|...|.|||.|..|:|.||.:||:.:||...:
 Frog   225 EAYPMFTNNSRVKRRPGPYEVEISEGPQTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPD 289

  Fly   120 KRLSRIETLRLAITYIGFMAEL---------------------------------------LSGT 145
            |:||:.|.||||:.||.|:|:|                                       |.|.
 Frog   290 KKLSKNEILRLAMKYINFLAKLLDDQEEEGNQRNKGNKDNGMVQQELLQDMLSPNSSCGSSLDGV 354

  Fly   146 PS-NSHKSRSDVYGSMNGH--HQAPPP 169
            || :|:....|...|.:..  |||..|
 Frog   355 PSPDSYSEEHDTLDSKHSRNLHQAMLP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 22/47 (47%)
tal1NP_001135468.1 PHA03247 <6..195 CDD:223021 20/99 (20%)
bHLH_TS_TAL1 254..318 CDD:381549 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.