DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and ferd3l

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_012819629.1 Gene:ferd3l / 100124312 XenbaseID:XB-GENE-983144 Length:129 Species:Xenopus tropicalis


Alignment Length:74 Identity:53/74 - (71%)
Similarity:61/74 - (82%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIG 136
            |...:..|:||.:.|||:|||||||:||||||||||.||:|||||||||||||||||||||.||.
 Frog    52 SPMGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDLLRKKVPTFAYEKRLSRIETLRLAIVYIS 116

  Fly   137 FMAELLSGT 145
            ||.|:|..:
 Frog   117 FMTEMLKNS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 42/47 (89%)
ferd3lXP_012819629.1 bHLH_TS_FERD3L_NATO3 59..122 CDD:381421 51/62 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7522
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513995at2759
OrthoFinder 1 1.000 - - FOG0009159
OrthoInspector 1 1.000 - - oto103429
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.