powered by:
Protein Alignment Fer3 and ferd3l
DIOPT Version :9
Sequence 1: | NP_524322.1 |
Gene: | Fer3 / 41411 |
FlyBaseID: | FBgn0037937 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012819629.1 |
Gene: | ferd3l / 100124312 |
XenbaseID: | XB-GENE-983144 |
Length: | 129 |
Species: | Xenopus tropicalis |
Alignment Length: | 74 |
Identity: | 53/74 - (71%) |
Similarity: | 61/74 - (82%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 SSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIG 136
|...:..|:||.:.|||:|||||||:||||||||||.||:|||||||||||||||||||||.||.
Frog 52 SPMGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDLLRKKVPTFAYEKRLSRIETLRLAIVYIS 116
Fly 137 FMAELLSGT 145
||.|:|..:
Frog 117 FMTEMLKNS 125
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
92 |
1.000 |
Domainoid score |
I7522 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1513995at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0009159 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto103429 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2562 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3328 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 6.040 |
|
Return to query results.
Submit another query.