DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and neurod4

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001124513.1 Gene:neurod4 / 100124310 XenbaseID:XB-GENE-972704 Length:316 Species:Xenopus tropicalis


Alignment Length:164 Identity:53/164 - (32%)
Similarity:72/164 - (43%) Gaps:51/164 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QRPSTNGRANGSSSSSKKTRRRVASMAQRRA-ANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLS 123
            ::|...|     ....|.|:.|:.....||. ||.|||.||..||:|.:.|||.:|.::..::||
 Frog    57 EKPKKRG-----PKKKKMTKARLERFRVRRVKANARERTRMHGLNDALENLRRVMPCYSKTQKLS 116

  Fly   124 RIETLRLAITYI----------------GFMAEL---LSGTPSN----------------SHKSR 153
            :|||||||..||                ||:..|   ||...||                .|:.:
 Frog   117 KIETLRLARNYIWALSDILEQGQSTEGKGFLEMLCKGLSQPTSNLVAGCMQLGPQAMFLDKHEEK 181

  Fly   154 SDVY-GSMNGH---HQAP----PP--AIHPHHLH 177
            |.:. .|:.||   :|:|    ||  .|..||||
 Frog   182 SHLCDSSLTGHTYNYQSPGLPSPPYGNIDVHHLH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/48 (52%)
neurod4NP_001124513.1 bHLH_TS_NeuroD4_ATOH3 <69..137 CDD:381564 29/67 (43%)
Neuro_bHLH 138..256 CDD:372170 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.