DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and scxa

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001076538.2 Gene:scxa / 100034489 ZFINID:ZDB-GENE-060503-414 Length:204 Species:Danio rerio


Alignment Length:123 Identity:44/123 - (35%)
Similarity:58/123 - (47%) Gaps:29/123 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAY 118
            |||.:|  ..|.|              .|..:.||.|||.|||.|..::|.||..||..:||...
Zfish    68 VTPTIP--TGTIG--------------HVPEIRQRNAANARERDRTNSVNTAFTALRTLIPTEPA 116

  Fly   119 EKRLSRIETLRLAITYIGFMAELL-------SGTPSNS-HKSRSDVYGSMNGHHQAPP 168
            :::||:|||||||.:||..:..:|       .|.|.:| ..|.|:.|     ||...|
Zfish   117 DRKLSKIETLRLASSYISHLGNVLLVGEACGDGQPCHSGGPSTSNYY-----HHHGSP 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/47 (53%)
scxaNP_001076538.2 HLH 85..136 CDD:278439 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.