DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and pkdc

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:359 Identity:71/359 - (19%)
Similarity:119/359 - (33%) Gaps:125/359 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENVASWKVFYKERNTYGQYIPE-- 141
            :|.||     ::|.:.|     |.::. |.:.|.:....|:::...|......:.....|..|  
Zfish    29 SGYGE-----IIRVHLE-----GCDRP-SVVVKHVMFPQNQKHPGGWNTDISHQRKVRSYQVETY 82

  Fly   142 FEQMYKD----------AGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTE 196
            :.|.|..          |.|  |||          :::|||||||...||  ..|:..::....:
Zfish    83 WYQNYTTNENCRVPLCLAAK--SFG----------EEQLIVLEDLDVAGF--PVRKTYVNDAEIK 133

  Fly   197 ATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKELRENQLKAYIDA-----FPLYDASH 256
            |.|..:|.|||                                    .::|.     :|:....|
Zfish   134 ACLSWIANFHA------------------------------------LFLDVTPEGLWPIGTYWH 162

  Fly   257 LTNDVQAYGSQADDMFQSFAPKIEG-----EFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQM 316
            |....:...:.:|...::.|.:|:.     .|:.:.||||...|..:..|.    .:|..||.|.
Zfish   163 LETRPEELEAMSDQKLKAAAGEIDSILNNCRFKTIVHGDAKLANFCFSKDG----LQVASVDFQY 223

  Fly   317 SRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESL----------------------- 358
            .......:|::|.:.|..:......|...|:.:|..:|.:||                       
Zfish   224 VGGGCGMKDVIYFLGSCMDERECEKKAPGLLDYYFSELRKSLEKKVDFAELEKEWRNMFAFAWTD 288

  Fly   359 -------------KLLKYPKPLPS--LRSLHQSI 377
                         |:.||.|.|..  |:.|.||:
Zfish   289 FHRFLLGWMPGHHKINKYSKRLTQEVLKKLKQSL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 62/339 (18%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 48/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.