DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31370

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:411 Identity:95/411 - (23%)
Similarity:178/411 - (43%) Gaps:39/411 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IPAWLDQQKFEPIL---ERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISY 108
            :|.||::|....:|   |:: ||| ::......|.:.||:||.::::||..|.....|      :
  Fly    12 VPEWLNEQFVTDVLRSHEKE-PDL-RVTKLDFTPGSAKGDNYASVIIRARVEYITQKG------F 68

  Fly   109 MAKILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAG--KKISFGPRYYESQIELDDELI 171
            .:|.|......|..|...:|..|...|.:.:|||.::.::..  .::.....||..:   ..:::
  Fly    69 FSKSLIIKTVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLE---PSQVM 130

  Fly   172 VLEDLGKRGFRNV-DRQNGLDIQHTE--ATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDS 233
            :.||||:..:..| ||.    :.|.|  ....|||:|||.|......:..:.:|:...:|.|...
  Fly   131 IFEDLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIP 191

  Fly   234 LKELRENQLKAYIDAFPLYD--ASHLTNDVQAYGSQADDMFQSFAPKIEGEFRVLNHGDAWCNNI 296
            .........|.::...|..|  .:|.......:..:..|:.:.:....:..:.||.|||....||
  Fly   192 YMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNI 256

  Fly   297 MYQYD-EAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKL 360
            |.::: |:|...:...:|.|....:..|.||:|.|......:.:|.:.:.|:.:|...|.|:|:.
  Fly   257 MVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRK 321

  Fly   361 LKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMFKN 425
            :.|...||...:..:.::...|:....:|..||:.:     ..::::..: |...||:::     
  Fly   322 IGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSV-----GLSLETATN-EETDDKLQD----- 375

  Fly   426 HRVIKHQKEILPWAHRRGAFE 446
              .|:..|.||....|.|.||
  Fly   376 --FIEECKSILARFERSGYFE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 67/289 (23%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 67/289 (23%)
APH <202..320 CDD:279908 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.