DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31098

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:413 Identity:93/413 - (22%)
Similarity:181/413 - (43%) Gaps:46/413 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PAWLDQQKFEPILERDFPDLKKIKSFRLEPTAGKGE---NYTTLLLRANFELELNDGSEQSISYM 109
            |.||..:..:.:|:..|.:.:...:..:..:|..|:   .:.:.:.||:|.|:.....:...|.:
  Fly    11 PEWLTAEFLQDVLKEHFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASFNLQRGTAPKGKFSVI 75

  Fly   110 AKILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPR-YYESQIELDDELIVL 173
            .|..|...........|:|.:|...|.:.:|..:.:.:..|.:....|. ||.:  |..:..::|
  Fly    76 VKDHPKGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYTT--ESPEPFLIL 138

  Fly   174 EDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKELR 238
            ||:...||.|.:|...|::.:...|:||:|:.||.||:   :....||     :....|.....|
  Fly   139 EDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSAL---IAQDSPE-----VLEFFDEAPISR 195

  Fly   239 ENQLKAYIDAFPL------YDASH----------LTNDVQAYGSQADDMFQSFAPKIEGEFRVLN 287
            ....:.::..||:      .:.:|          :.|..:....:|..||:|...    :|||.|
  Fly   196 NPDRRDFLTFFPVNIRCVAEEVAHWKGYEEITEKMFNLAENVLQRALTMFESTGK----DFRVFN 256

  Fly   288 HGDAWCNNIMYQY-DEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYH 351
            ..|.|.||:::.. :|..:..:|..:|.|::...||..||.|.:..|...:::...:.|:::.|.
  Fly   257 LTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRKVHYKYIVREYQ 321

  Fly   352 EKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIV--SILLPLVLIDGGDDANMDSLMDGEGA 414
            ..|.::|:.|.|...:|:|:.:|  |.:....::.::  :.|.||:..:|....|::.|.....:
  Fly   322 RVLQQTLEKLNYQGHIPTLKEIH--IELIKTSLMGVIGATCLTPLIFREGAGFENLEDLNSRTES 384

  Fly   415 GDKIRNNMFKN-------HRVIK 430
            ||:.|....:|       .|.||
  Fly   385 GDRFRRENVENPKYRAFLQRTIK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 69/302 (23%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 68/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.