DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG13658

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:383 Identity:96/383 - (25%)
Similarity:183/383 - (47%) Gaps:31/383 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PAWLDQQKFEPIL---ERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYM 109
            ||||:.:..|..|   |:| |:| .:...::.|...:|::|.:::.||........|: .|.:.:
  Fly    18 PAWLNAELIEGALRAYEKD-PEL-HVTDLKISPATLQGDHYASVMFRAVSHYSTAKGN-FSKALI 79

  Fly   110 AKILP-NSGNRENVAS-WKVFYKERNTYGQYIPEFEQMYKDAGKKIS-FGPRYYESQIELDDELI 171
            .|.:| ..|:::::.| ..:|..|...|.:.:||.|::.::||.... :.|..|.| :| ..:::
  Fly    80 VKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHS-LE-PHQVM 142

  Fly   172 VLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKE 236
            :.|||..:|: .|.|....:.:..:....|||::||||......:..:.:|:...|..:.:.|.:
  Fly   143 IFEDLVPQGY-TVIRDRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLWGMPNFLND 206

  Fly   237 -LRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEFR---------VLNHGDA 291
             :....:..:::.  |.....||.....:....|:..|..:..:| |:|         ||.|||.
  Fly   207 SIVTTGVPCFLEM--LDKVPELTKYKPYFEKIKDNYIQQMSAVME-EYRTNPKPNRYYVLCHGDF 268

  Fly   292 WCNNIMYQYD-EAGKLAEVNFVDLQMSRFSSPAQDLLYLI--LSSTELDIKIAKFDYLIKFYHEK 353
            ...|:|::|: |.|...:|..||.|:|.....:.||:|.|  :..||....:.| :| |.:|...
  Fly   269 HGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGK-EY-INYYFSV 331

  Fly   354 LIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLV-LIDGGDDANMDSLMD 410
            |.::||.:.:...:|:...:.:.|..:.|:...:::..|||| .::.....:|||..|
  Fly   332 LADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTFKSMDSFFD 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 74/297 (25%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 74/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.