DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31104

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:395 Identity:94/395 - (23%)
Similarity:174/395 - (44%) Gaps:51/395 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PAWLDQQKFEPILE--RDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMA 110
            ||||:.|....||.  ...||| |:...::.|...:|::|.:::.|...|.....|.... ..:.
  Fly    16 PAWLNAQFIGDILREYEQLPDL-KVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFFK-PLII 78

  Fly   111 KILP-NSGNRENVASWK-VFYKERNTYGQYIPEFEQMYKDAGKKIS-FGPRYYESQIELDDELIV 172
            |.:| ..|:::::.|.. :|..|...|...:||||::.::||.... |.|..|.|.  ...::::
  Fly    79 KTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHSL--KPRQVMI 141

  Fly   173 LEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKEL 237
            .|||..:|: .|.|.:...:...:...:|||::||.|......:..:.:|:...|..:       
  Fly   142 FEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQYGLFEM------- 198

  Fly   238 RENQLKAYIDAFPLYDASHLTN---------DVQAYGSQADDMFQSFAPKIEGE----------- 282
                  ..||..| :..:.:||         :::.|....:.:..::..::|.|           
  Fly   199 ------PTIDTDP-FITTGMTNFIEMLDKMPELRKYKHHFEKIKDNYMQRLEVEMHEYHKYRRND 256

  Fly   283 -FRVLNHGDAWCNNIMYQYD-EAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDY 345
             :.||.|||....|:|:::: |.|...:|..||.|:|.......||.|.:....|.:.:....:.
  Fly   257 RYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGEN 321

  Fly   346 LIKFYHEKLIESLKLLKYPKPLPSLRSLHQSI--FIYGDWILPIVSILLPLVLIDGGDDANM-DS 407
            ||..|...|:.:|:.:.|...:|:.|.|.:.|  ..|.|:.|  :|..||:::....:|..| ::
  Fly   322 LINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFL--ISTFLPIMVGVKSNDLKMHEA 384

  Fly   408 LMDGE 412
            |.|.:
  Fly   385 LQDSQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 67/306 (22%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 67/306 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.