DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG6834

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:442 Identity:146/442 - (33%)
Similarity:236/442 - (53%) Gaps:31/442 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VMKPIKSSPHAKLSKQQRQQVNDMVRETEDIAIEPIPAWLDQQKFEPILERDFPDLKKIKSFRLE 76
            |:.|  .:|.::..:..:.|:.|               ||:...|..::....|:..||......
  Fly   477 VVAP--ETPSSEQPENPKNQILD---------------WLNVSDFAEVISSAEPEFDKIVGGSWS 524

  Fly    77 PTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENVASWKVFYKERNTYGQYIPE 141
            .....|:|:.:.||:.:.|.:|.|.:.::.||:.|:.|.| ..:|.....:|.||...|.:|:|.
  Fly   525 SATKPGDNFASKLLKIDIETQLKDHTSKTFSYILKVQPKS-TPDNFTDVNMFPKEMEMYQKYVPA 588

  Fly   142 FEQMYKDAGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFH 206
            |||:|||||..::|....:.....:.:|.:::|:|..:||:..||..||:::||:::|:||||:|
  Fly   589 FEQLYKDAGLTVTFTANSFVLNKAVKEEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWH 653

  Fly   207 AASAVRFELKGSYPEEYNQNLCSVVDSLKELRENQL----KAYIDAFPLYDAS--HLTNDVQAYG 265
            |||....||.|:||..||..:  .::..:::..|..    :|||..|..::.:  :|........
  Fly   654 AASIKYKELNGAYPPLYNDGI--YIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPKLEWIID 716

  Fly   266 SQADDMFQSFAPKI-EGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYL 329
            :..|.:.:.  .|| |..|.||||||||.||||:|||..|:|.|...:|.|.:::.:|||||.|.
  Fly   717 NHVDQVLED--AKINEQAFNVLNHGDAWINNIMFQYDAEGRLKETYLLDHQNAKYGNPAQDLYYF 779

  Fly   330 ILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPL 394
            ::||.|||||:.:||.||:||||.|:|..|||||...:|||..||..:..:..:.:..|...|.:
  Fly   780 LISSAELDIKVDEFDNLIRFYHENLVEHTKLLKYNGFVPSLSELHAILIEHPAFAVGTVISTLTV 844

  Fly   395 VLIDGGDDANMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFE 446
            .|.|.|.:..:..:...|  .:..|..:..|.|...|.::|:||.:|||..:
  Fly   845 CLTDEGFNPELFFVETPE--SEAFRTKLLGNERYKAHVEKIMPWLNRRGLLD 894

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 112/288 (39%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 112/288 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442543
Domainoid 1 1.000 57 1.000 Domainoid score I17979
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.