DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG6830

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:455 Identity:154/455 - (33%)
Similarity:242/455 - (53%) Gaps:38/455 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLQTEKLPVMKPIKSSPH--AKLSKQQRQQVNDMVRETEDIAIEPIPAWLDQQKFEPILERDFPD 66
            ::.|:.||        |.  |.|..||.|..|          .:.||.||:...|:.|:....|:
  Fly   455 EVSTDPLP--------PELLAALKPQQPQPEN----------TDQIPDWLNIDDFKEIILSAEPN 501

  Fly    67 LKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRE-NVASWKVFYK 130
            .:||.|...:.....|:|:.:.||:...|.:|.|.|.::.||:.|:  :|.|.. |.:.:.:|.|
  Fly   502 FEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKV--HSDNDAINFSDFNLFPK 564

  Fly   131 ERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHT 195
            |...|..|:|.||:.|||.|..::|.|:.:....::..|.::||:|...||:.|||..|:|::|:
  Fly   565 EIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHS 629

  Fly   196 EATLEKLAQFHAASAVRFELKGSYPEEYNQNLCS--VVDSLKELRENQLKAYIDAFPLYDASHLT 258
            :.||:||||:||||....||.|.|..:||..:.:  .....|.:..|..|::|:....:|.    
  Fly   630 KCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDG---- 690

  Fly   259 NDVQAYGSQADDMFQSFAPKI-------EGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQM 316
              |..|..:..::..::..:|       |..|.||||||||.||||:||:..|::.|...:|.|:
  Fly   691 --VDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQV 753

  Fly   317 SRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYG 381
            :::.:|||||.|.|:|||:||||:.:|||||::||:.:.|..|||.|...:|||:.||..:..:.
  Fly   754 TKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHP 818

  Fly   382 DWILPIVSILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFE 446
            .:....|...|.:.|....||...||.:..|..|..:|..||.|.|...:.:.::||.:|||..:
  Fly   819 IFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNERYRANIERVMPWINRRGLLD 883

  Fly   447  446
              Fly   884  883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 109/291 (37%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 109/291 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442523
Domainoid 1 1.000 57 1.000 Domainoid score I17979
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.