DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG5644

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:409 Identity:105/409 - (25%)
Similarity:164/409 - (40%) Gaps:87/409 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KIKSFRLEPTA-----GKGENYTTLLLRANFELELND------GSEQSISYMAKILPNSGNRENV 122
            |:.||.:...|     ..|:||.:::.|........|      |||.....:.:.:.:...|:..
  Fly    47 KLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKRQIASLSRRQLY 111

  Fly   123 ASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGP--RYYESQIELDDE----LIVLEDLGKRGF 181
            ...:.|..|.|.|....|...     |..:....|  ...|||...|.|    :|||:||...||
  Fly   112 RCEEAFSNEINAYRHLAPLLA-----AHSRHQLFPVCHIAESQDRRDAEGGEPIIVLQDLKAMGF 171

  Fly   182 RNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGS-------------YPEEYNQNLCSVVD- 232
            |..||..||::......::||||.||||....||:.|             |.:|......:::| 
  Fly   172 RMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDEATDFYATILDT 236

  Fly   233 SLKELRENQLKAYIDAFPLYDASH---LTNDVQAYGSQADDMFQSFAPKIEGEF----RVLNHGD 290
            |:::..|:          |.||:.   ||..::.......::|::...:|....    .|:.|||
  Fly   237 SVQQALES----------LGDANADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNSVICHGD 291

  Fly   291 AWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYH---- 351
            .|.||||::.:.    .||.|.|||..|.|||..|:|:.|.:||...::....|.|:..|.    
  Fly   292 LWVNNIMFRSEP----EEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALS 352

  Fly   352 ----------------EKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGG 400
                            |:|.|:..|.:.....  :|.:|..:.| |.||||.|:       .|..
  Fly   353 EELRHQLEDTTAAERLEELCEAFSLQRLSSDY--VRQVHYGLAI-GMWILPAVT-------FDPN 407

  Fly   401 DDANMDSLMDGEGAGDKIR 419
            :..|:|.:.:....|.:|:
  Fly   408 NLPNLDVMSEQNLTGKEIK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 87/334 (26%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 83/310 (27%)
P-loop_NTPase <357..435 CDD:304359 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.