DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG11889

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:425 Identity:114/425 - (26%)
Similarity:203/425 - (47%) Gaps:45/425 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PAWLDQQKFEPILERDFP-DLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSE-QSISYMA 110
            ||||.::..|..|...|. |...:|...::|....||||.:::.|.:.|....|..: ||.:::.
  Fly    10 PAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATFLL 74

  Fly   111 K-----------ILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQI 164
            |           :|.|.|         ::.:|.:.|.|.:|....:.|:   ::....:.:.:.:
  Fly    75 KTTFADKDPAAHLLINYG---------IYTREIDMYEQILPRLADIVKN---ELHDSRKLFAATV 127

  Fly   165 ELDDE--LIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELK-GSYPEEYNQN 226
            .:|.|  .|:.|||....::...|...||::||...|||||.||||.|...:.: |.:.:.|::.
  Fly   128 GVDRERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRG 192

  Fly   227 LCSV-VDSLKELRENQLKAY---IDAFP----LYDA--SHLTNDVQAYGSQADDMFQSFAPKIEG 281
            ..:. |...:.:.:|.|||.   :|..|    .|.|  ..|.::|..||.::    .|.||   |
  Fly   193 FFNKHVRGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERS----TSVAP---G 250

  Fly   282 EFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYL 346
            :|..|.|||.|..|:|:|||:.|......|:|.|.|.::|||.||.|...:|...::::.:...|
  Fly   251 DFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTEL 315

  Fly   347 IKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDANMDSLMDG 411
            ::||..||:.:|:.:||...:|||....|.....|.:.:....|..|.::.:|.::.:::..|..
  Fly   316 VQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTS 380

  Fly   412 EGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFE 446
            :..|.::|:.:::....:|.....||:..:.|..:
  Fly   381 DEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 87/306 (28%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 87/306 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.