DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG16898

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:422 Identity:110/422 - (26%)
Similarity:201/422 - (47%) Gaps:38/422 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IPAWLDQQKFEPILERDFPD--LKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYM 109
            :|.||.::..:|.|...:.|  ||.:|.: .:|...||:||.:|:.|.:.|::..||..|:.:|:
  Fly     2 LPNWLTEEYLQPKLRAYYKDDQLKVVKVW-AKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYI 65

  Fly   110 AK--ILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELDDE--L 170
            .|  :..:....:....:.|:.:|.:.|...:|:..::.::.|    ...::....|.:|.|  .
  Fly    66 IKESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVG----LTGKFTADTIFVDREYRT 126

  Fly   171 IVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNL---CSVVD 232
            |:||||.:..:.|.||...||:.||:.|||.||:|||||.|   :|..:||...::|   |...|
  Fly   127 IILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIV---VKQRHPELLTKSLFIHCFSRD 188

  Fly   233 S--LKELRENQLKA---YIDAFPLYDASH------LTNDVQAYGSQADDMFQSFAPKIEGEFRVL 286
            :  ..|:.|..|.|   :|:..|:....:      :..::..||::..::.       |.|...|
  Fly   189 NKGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVG-------EQELLTL 246

  Fly   287 NHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYH 351
            :|||.|..|.:||||:|........:|.|.|.|:||..||......|...:::..: ..|::.|:
  Fly   247 SHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDME-SVLVEKYY 310

  Fly   352 EKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGD-DANMDSLMDGEGAG 415
            ..|..::..|.|....|||:.. |..|....::..:..:..|:::.||.: .::..|:......|
  Fly   311 SDLKTNVDTLSYKGIFPSLQGF-QKQFESRRFMCLLAHLFKPVIIYDGTEVSSDFSSVYKDTEEG 374

  Fly   416 DKIRNNMFKNHRVIKHQKEILPWAHRRGAFEI 447
            .:.:..::.|.||:|...::|.....:|...:
  Fly   375 IRFQKAIYANERVLKSATKLLAMLDAKGVLNL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 83/299 (28%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 83/299 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.