DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and JhI-26

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:411 Identity:101/411 - (24%)
Similarity:163/411 - (39%) Gaps:97/411 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YTTLLLRANFELELNDGSEQSISYMAKILPNSGNR--ENVASWKVFYKERNTYGQYIPEFEQMYK 147
            |.|.:   |||.   ||.:.....:.|..|.....  |::....:|..|.|.|.:.:||| |.:.
  Fly    59 YRTTI---NFEY---DGQKFQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEF-QKFT 116

  Fly   148 DAGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVR 212
            | ||..:  |:||..::.....:.:||:..::|:|....:.||.:||....:..|.:||..:   
  Fly   117 D-GKFAA--PKYYYGELNQHSAVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFA--- 175

  Fly   213 FELKGSYPEEYNQNLCSVVDSLKELR---EN-------QLKAYIDAFPLYDASHLTNDVQAYGSQ 267
            :.:|...||::.|    :.|:|||.|   :|       .:|..||        .....|..|..|
  Fly   176 YAMKHKNPEKFAQ----LTDNLKESRYANDNIHPEWKLTMKTSID--------RAAKAVATYQPQ 228

  Fly   268 ADDMF----------------QSFAPKIEGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQM 316
            .|:.|                |..||:  .....|.|||...||:.|:||:..:..|:...|.|.
  Fly   229 IDEEFVKKFCFMISDYSQYGRQRVAPR--EPLATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQT 291

  Fly   317 SRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFY----HEKLIESLK-----------LLK-YPK 365
            .|.|||..||...:..|...:::...|:.:...|    |....|..|           ||| |.:
  Fly   292 LRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSYREHAKEEVPDFLSRGELLKEYVR 356

  Fly   366 PLPSLRSLHQSIFIYGDWILPIVSILLPLVL-------IDGGDDANMDSLMDGEGAGDKIRNNMF 423
            .||...|:..|.         ::|::.||.:       :...|:..::..|:  ..|:.:     
  Fly   357 FLPYSLSISASF---------LMSLVDPLDISPEEMFALQLSDEEIIERTMN--RGGEVV----- 405

  Fly   424 KNHRVIKHQ-KEILPWAHRRG 443
              .|.:.|| ||:|..:...|
  Fly   406 --DREVAHQVKEMLELSQATG 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 83/321 (26%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 77/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.