DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG9259

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:399 Identity:91/399 - (22%)
Similarity:161/399 - (40%) Gaps:81/399 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 IKSFRLEPTAGKGENYTTLLLRANFELELNDGSE-QSISYMAKILP--NSGNRENVASWKVFYKE 131
            |.::.|:||:.....|....|..:..|:|::..| :.:::.:|..|  |....|.:..:.||.||
  Fly    33 IVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSEEVRQLTFFSKSAPVGNESRMEYLEDFGVFEKE 97

  Fly   132 RNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELDDELIVLEDLGKRGFR-NVDRQNGLDIQHT 195
            ...|...:|:..:...:...|.     ||     .|..|::.|:|..:|:| ...|...|..:..
  Fly    98 IAVYQNVLPDLHKACAEVAPKC-----YY-----ADKNLLIFENLADQGYRMGAGRDGLLTYEQL 152

  Fly   196 EATLEKLAQFHAASAVRFELKG--------------SYPEEYN---------QNLCSVVDSLKEL 237
            ...|:.||..||.|.::.:..|              :||.:.:         ||.|.|       
  Fly   153 HCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSDVSPEHMRMVNFQNACLV------- 210

  Fly   238 RENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEFRVLN----------HGDAW 292
                ||.:|...|.|.            |:.|.:.::|..|:...|..:.          |||.|
  Fly   211 ----LKEFIKLIPKYQ------------SKLDYVLENFTEKMSFIFEAVKTSDVYQNTILHGDLW 259

  Fly   293 CNNIMYQYDEAGKL-AEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIE 356
            .||||:||...|:: .:...||.|::|::.|..|:|.::...|..:.:.|....|:..|:..:.|
  Fly   260 ANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTE 324

  Fly   357 SLKL--LKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDANMDSLMDGEGAGDKIR 419
            .||.  |...:.:|. ::.::|:..:....|....:...||::.......:.|.:||       .
  Fly   325 FLKRADLDIARFIPE-QTFYESVQKFRSVGLIESCLFCHLVILPPHCTQKLTSSVDG-------F 381

  Fly   420 NNMFKNHRV 428
            |:.|.|.|:
  Fly   382 NDFFTNKRI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 75/321 (23%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 71/303 (23%)
APH <252..325 CDD:279908 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.