DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG33511

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:307 Identity:83/307 - (27%)
Similarity:137/307 - (44%) Gaps:47/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GENYTTLLLRANFELEL-NDGSEQSISYMAKILP--NSGNRENVASWKVFYKERNTYGQYIPEFE 143
            ||.|     :.:.|.|: .|..:..::|..|.||  |...||......||.||...|.|.:|:.:
  Fly    44 GEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQ 103

  Fly   144 QMYKDAGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAA 208
               |.|.||:.  |:.|.|:    ::::||||| .:.:|::.......:.|.:..||.|::.|||
  Fly   104 ---KYATKKLY--PKCYYSR----NDILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSELHAA 158

  Fly   209 SAVRFELKGSYP--EEYNQNLCSV-VDSLKELRENQLKAYIDAF-----PLYDASHLTNDVQAYG 265
            | :.:|.|.:..  |.|...|..: :||........|||.:  |     |.:......|.:|   
  Fly   159 S-IAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIV--FLAARNPHFQTMKAQNFIQ--- 217

  Fly   266 SQADDMFQSFAPKIEGEF--------RVLNHGDAWCNNIMYQYDEAGKLA--EVNFVDLQMSRFS 320
                |...:...|.| |.        .||.|.|.|.:||:|.:::...:.  ....||.|::::.
  Fly   218 ----DKLYNLLTKAE-ELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYC 277

  Fly   321 SPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPL 367
            ||..|:|:|:......:::.|.:|..::.|::.|...|..|...|.|
  Fly   278 SPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 81/301 (27%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 80/300 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.