DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG5126

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:411 Identity:84/411 - (20%)
Similarity:143/411 - (34%) Gaps:134/411 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELDDELIV----------- 172
            ||:..|:..|..|...|.:.:|.:|.:.:.:               .|:.|::.           
  Fly    77 RESSNSYIQFSNEIFAYAEILPAYENVLRTS---------------HLESEVVKNWVPCCYFARF 126

  Fly   173 --LEDLGKRGFRNVDRQNGLDIQH------------------TEATLEKLAQFHAASAVRFELKG 217
              :|.||.      .|::.|.::|                  .||.:..:..||   |:.:..|.
  Fly   127 GHVEGLGN------GRESVLALKHLKGDGYQLGPRLTLRRDQLEAMVGLVGPFH---ALGYATKI 182

  Fly   218 SYPEEYNQNLCSVVD------SLKELRENQLKAYIDAF-PLYDASH---LTNDVQAYGSQADDMF 272
            ..|..:.:....|||      |.|.:.:...:...|.| ..||...   |......:|:..:.:.
  Fly   183 LQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLR 247

  Fly   273 Q----------------SFA-PKIEGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFS 320
            :                ||| .:.:..|....|||...||:::.|....|:..:..:|.|..|||
  Fly   248 EKYFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFS 312

  Fly   321 SPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRS------------- 372
            :.|.||.:.:..:|..:.:...:..|::.||..:||.|:|:        ||.             
  Fly   313 TTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELV--------LRRNRNELTDDRVDQL 369

  Fly   373 LHQSIF-----------IYGDWILPIVSI-LLPLVLIDGGDDANMDSL----MDGEG-------- 413
            |.:..|           .||    |:|.: .||.:|....|.|.:..|    |.|..        
  Fly   370 LQEYSFERFNAHFKRYAFYG----PMVCMHFLPWLLGTEKDCAELSRLFETDMHGPAFHQLSLDI 430

  Fly   414 AGDKIRNNMFKNHRVIKHQKE 434
            |||:....:||   .::|..|
  Fly   431 AGDEANQEIFK---TVRHAYE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 61/301 (20%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 60/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.