DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31974

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:413 Identity:104/413 - (25%)
Similarity:181/413 - (43%) Gaps:87/413 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENVA 123
            ::|...|:...:.|:........|:||.:::|....::...||..:.:..:||:.|.:    |..
  Fly    13 VIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLT----NDL 73

  Fly   124 SWKVFYKER-----NTYGQYI-PEFEQMYKDAG---KKISFG-PRYYESQIELD--------DEL 170
            .|::|..||     |...||: ||.:::..::|   .:|..| ||||.|::.||        |.:
  Fly    74 YWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAV 138

  Fly   171 IVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAAS-AVRFELKGSYPEEY----------N 224
            :|.|::..||:|..:|....::..|...|..|||:||.. |:|.:....| |||          |
  Fly   139 LVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVY-EEYVRPYFKKFDMN 202

  Fly   225 QNLCSV------VDSLKELR--------ENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSF 275
            .|:...      .:.||:::        .|::|..:|.|..:.||   |||       ||     
  Fly   203 SNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQAS---NDV-------DD----- 252

  Fly   276 APKIEGEFRVLNHGDAWCNNIMYQY---DEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELD 337
                 |.|..|.|||.|.||:|.:|   .|.|...:|..||.|::::.|...|:::::.||.:::
  Fly   253 -----GPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVN 312

  Fly   338 IKIAKFDYLIKFYHEKLIESLKLL-----KYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLI 397
            :....|...:..|:...|::|:.:     .|...| .|..:.|:..:.    ||....::.::|.
  Fly   313 VLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYEL-FLEEVQQTAHVQ----LPHAIFMMKVILA 372

  Fly   398 DGG------DDANMDSLMDGEGA 414
            |..      .|.:...|....||
  Fly   373 DNSTIPKDYKDVDFSVLTKNTGA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 89/332 (27%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 89/326 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459624
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.