DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31300

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:449 Identity:108/449 - (24%)
Similarity:191/449 - (42%) Gaps:60/449 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KQQRQQVNDMVRETEDIAIEPIPAWLDQQKFEPILE--RDFPDLKKIKSFRLEPTAGKGENYTTL 88
            |...:|.||...|.        ||||::|..|.||.  .|.|:| |:...::.|.:.:|::|.::
  Fly     4 KLDAEQFNDDELEA--------PAWLNRQFIEEILSAYEDSPEL-KVVDLKITPASAQGDHYASV 59

  Fly    89 LLRANFELELNDGSEQSISYMAKILP-NSGNRENVASWK-VFYKERNTYGQYIPEFEQMYKDAGK 151
            :.|...|.....| :.|...:.|.:| ..|:::::.|.. :|..|...|.|.:||||::.:::|.
  Fly    60 MFRTTAECTTAKG-KFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGD 123

  Fly   152 KIS-FGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFEL 215
            ... |.|..|.| :| ..::::.|||..:|: .|.|...:..:..:....|||::||.|....:.
  Fly   124 DTKLFVPCIYHS-LE-PRKVMIFEDLVPQGY-YVIRDRPVAQEELKTAFAKLAKWHAISMKYIKE 185

  Fly   216 KGSYPEEYN-------------------QNLCSVVDSLKELRENQLKAYIDAFPLYDASHLTNDV 261
            :..:.:|:.                   |:...::|.|.|||:.:             .|.....
  Fly   186 QPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYK-------------PHFEKIK 237

  Fly   262 QAYGSQADDMFQSFAPKIEGE-FRVLNHGDAWCNNIMYQYDE-AGKLAEVNFVDLQMSRFSSPAQ 324
            ..|..:...:.:.:....:.: |.||.|||....|:|::.:: .|...:...||.|:|.......
  Fly   238 DKYMQRLQAVMKEYHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITI 302

  Fly   325 DLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIF--IYGDWILPI 387
            ||.|.|....|.:.:......||..|...|:.:||.:.||..||:...|...|.  .|.|:.|  
  Fly   303 DLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFL-- 365

  Fly   388 VSILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFE 446
            :|..|||:|........::.|:.    ..:.|...:.....:|...::||...:.|.|:
  Fly   366 LSTFLPLILAIKSKSFKVNDLIQ----DPETRQKTYFLDTYVKDVSKLLPKFEQLGYFK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 69/305 (23%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 69/305 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.