DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG31099

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:412 Identity:124/412 - (30%)
Similarity:211/412 - (51%) Gaps:31/412 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IEPIPAWLD----QQKFEPILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQ 104
            :..||.|:.    .|....:||........|.|..|.....     .|:||....:::|.|.:.:
  Fly     3 VPKIPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRN-----CTVLLPIQVKVQLRDFTMK 62

  Fly   105 SISYMAKILPNSGNRENVAS-WKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELDD 168
            .:.::.|....:..:..|.: .|:|.:|...|...:|:.|::|::.|||:|||||.:.....:..
  Fly    63 KLFFLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGV 127

  Fly   169 ELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPE-----EYNQNLC 228
            :.::||||..:.::||:||.|.:....:..|:|||||||||||..|..|::..     .|.:...
  Fly   128 QYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANE 192

  Fly   229 SVVDSLK--ELRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEFRVLNHGDA 291
            ||:..|.  |:..:||:.:    .|.|..| ...|:......|.:.:..:|. ..||.||||.|.
  Fly   193 SVLQELNDPEIFLSQLRRW----RLGDHFH-KRLVEKEKDLVDGLLKLHSPD-SNEFNVLNHSDC 251

  Fly   292 WCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIE 356
            |.||:|:::|::|.:.:...:|.|:.::.|||.||.|.||||.|.|||:|:||.::::|...|::
  Fly   252 WVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLD 316

  Fly   357 SLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDG-GDDANMDSLMDGEGAGDKIRN 420
            :||.|.:...||.|:.:..::...|.....:|:..||:.:::. .|:.|       |....|::.
  Fly   317 NLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVN-------ERYASKMKC 374

  Fly   421 NMFKNHRVIKHQKEILPWAHRR 442
            .||.:.:.|:..|:||||...|
  Fly   375 AMFTSRKYIQAIKDILPWMEER 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 95/289 (33%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 95/284 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26787
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.