DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6908 and CG1561

DIOPT Version :9

Sequence 1:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:453 Identity:112/453 - (24%)
Similarity:195/453 - (43%) Gaps:84/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KPIKSSPHAKLSKQQRQQVN---------------DMVRETEDIAIEPIPAWLDQQKFEPILERD 63
            |..:..||.....::..:||               |..:..||:..|.:..:|.|     ::.:.
  Fly   180 KEAEPDPHEDTEDERNGEVNREHPDRMESPVEQQEDTAKPDEDLPNEQVTQFLRQ-----LVSQL 239

  Fly    64 FPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILP-NSGNRENVASWKV 127
            :|:|......|||..:.||:||..::.|      |...|:...|.:.|:.| |...|:...:...
  Fly   240 WPELGANPELRLERASAKGDNYLGVVWR------LQAASDSKRSLVVKLPPQNRVRRKQFFARPC 298

  Fly   128 FYKERNTYGQYIPEFEQMYKDAGKKIS----------FGPRYYESQIELDDELIVLEDLGKRGFR 182
            |.:|...|..::| ...:.:|..|.|.          ||.|..|     .:|.||||||...||.
  Fly   299 FLRETAAYEVFLP-LTALIQDKWKIIGDDRFRQHALCFGTRQDE-----PNECIVLEDLSCAGFS 357

  Fly   183 NVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKE----------- 236
            ..:|...|.::|....:...|:.||.|...   |...||:. |.|..:||..::           
  Fly   358 LHNRFLDLSVEHVRRVMLTYAKLHAISLAG---KRQLPEKM-QQLQQLVDIFEQRRDDHALGVYF 418

  Fly   237 --LRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIEG----EFRVLNHGDAWCNN 295
              |:|:.|.|.:  .|..||..:.  ::||.::. ..|:...|.:.|    .|.|:.|||.|.||
  Fly   419 ENLKESALSALL--APADDAYRVR--LEAYFARG-SYFELLLPLVSGFNCEPFAVICHGDCWNNN 478

  Fly   296 IMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKL 360
            |:|:..|.|:|.:|..:|.|:.|::||..||.|.:.:.|....:....:.:::.|:|:|  .|:|
  Fly   479 ILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEEL--GLQL 541

  Fly   361 LK--------YPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDANMDSLMDGEGAG 415
            ::        :|:|     :..:.:.......|.:..::||:|.:.|.|..::.::.:...||
  Fly   542 IRLGERVEQLFPRP-----AFDEQVATKAAVGLLLAMMVLPIVTMQGQDVPDLQAISERIEAG 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 86/317 (27%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 86/311 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.